DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and AT3G20800

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_188716.1 Gene:AT3G20800 / 821628 AraportID:AT3G20800 Length:316 Species:Arabidopsis thaliana


Alignment Length:281 Identity:145/281 - (51%)
Similarity:194/281 - (69%) Gaps:5/281 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPVMSPQQQAEREKVYQLIIELAYPATRETALLELSK--NTYADLAPMLWKSVGTTCTLLQEIVN 68
            :|....:..|..|   ||:::|:.|..||.|||||||  ..:.||||:||.|.||...||||||:
plant    27 APANKDRNLASAE---QLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVS 88

  Fly    69 IYPIITTPVLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLSTTFKSRPFEQLRL 133
            ||.::..|.|...||||||.:|.||||||||.:||..||:..||:||||||:||.||||||.|||
plant    89 IYSVLAPPNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRL 153

  Fly   134 TTLGVINALAETGDTEVLIFLIWSEVVPHCLTNMVRGSKLTKIAATSILEKILLDEMGLTYICEN 198
            |:||||.||.:..||||:.||:.:|::|.||..|..||:|:|..||.|::|||||::|:.|||..
plant   154 TSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTT 218

  Fly   199 HDRFSQVAITLGKMVIHMLKFPCLRVLKHVVRCYLLLTENARARSALRVCLPDLLRDGTFTSLVQ 263
            .:||..|...||.||..:::.|..|:|||::||||.|::|.||.:||..||||.||||:|::.::
plant   219 AERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALASCLPDSLRDGSFSNCLR 283

  Fly   264 HDTCTKQWLQMLLKNLQTNAV 284
            .|...::|||.|:.|:....|
plant   284 EDPTARRWLQQLVHNVGVGRV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 136/248 (55%)
AT3G20800NP_188716.1 Rcd1 41..299 CDD:397961 139/257 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I597
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 1 1.000 - - mtm1000
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.