DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and cnot9

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_999925.1 Gene:cnot9 / 406632 ZFINID:ZDB-GENE-030131-1558 Length:298 Species:Danio rerio


Alignment Length:278 Identity:168/278 - (60%)
Similarity:206/278 - (74%) Gaps:3/278 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QAEREKVYQLIIELAYPATRETALLELSK--NTYADLAPMLWKSVGTTCTLLQEIVNIYPIITTP 76
            |.:|||:||.|.||:.|.|||.|||||||  .:..|||||||.|.||...||||||||||.|..|
Zfish    15 QVDREKIYQWINELSSPETRENALLELSKKRESVTDLAPMLWHSCGTIAALLQEIVNIYPSINPP 79

  Fly    77 VLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLSTTFKSRPFEQLRLTTLGVINA 141
            .|.|:||||||.||.||||||||.|||.|||...||::|||||.|..|:||||.||||:||||.|
Zfish    80 TLTAHQSNRVCNALALLQCVASHVETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGA 144

  Fly   142 LAETGDTEVLIFLIWSEVVPHCLTNMVRGSKLTKIAATSILEKILLDEMGLTYICENHDRFSQVA 206
            |.:|.:.||:.||:.:|::|.||..|..||:|:|..||.||:|||||:.||.|||:.::|||.||
Zfish   145 LVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVA 209

  Fly   207 ITLGKMVIHMLKFPCLRVLKHVVRCYLLLTENARARSALRVCLPDLLRDGTFTSLVQHDTCTKQW 271
            :.|||||:.:.|.|..|:|||||||||.|::|:|||.|||.||||.|:|.||..:::.|:.||:|
Zfish   210 MILGKMVLQLSKEPSARLLKHVVRCYLRLSDNSRAREALRQCLPDQLKDTTFAQVLKDDSTTKRW 274

  Fly   272 LQMLLKNLQTNAV-NPMG 288
            |..|:||||...| :|.|
Zfish   275 LAQLVKNLQEGQVTDPRG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 152/248 (61%)
cnot9NP_999925.1 Rcd1 32..282 CDD:281998 152/249 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.