DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and cnot9

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_989024.1 Gene:cnot9 / 394620 XenbaseID:XB-GENE-1001082 Length:299 Species:Xenopus tropicalis


Alignment Length:289 Identity:173/289 - (59%)
Similarity:211/289 - (73%) Gaps:3/289 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEPSPVMSPQQQAEREKVYQLIIELAYPATRETALLELSK--NTYADLAPMLWKSVGTTCTLLQE 65
            |..:||.:...|.:|||:||.|.||:.|.|||.|||||||  .:..|||||||.|.||...||||
 Frog     5 ATAAPVPAALAQVDREKIYQWINELSSPDTRENALLELSKKRESVPDLAPMLWHSFGTIAALLQE 69

  Fly    66 IVNIYPIITTPVLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLSTTFKSRPFEQ 130
            ||||||.|..|.|.|:||||||.||.||||||||||||.|||...||::|||||.|..|:||||.
 Frog    70 IVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEY 134

  Fly   131 LRLTTLGVINALAETGDTEVLIFLIWSEVVPHCLTNMVRGSKLTKIAATSILEKILLDEMGLTYI 195
            ||||:||||.||.:|.:.||:.||:.:|::|.||..|..||:|:|..||.||:|||||:.||.||
 Frog   135 LRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYI 199

  Fly   196 CENHDRFSQVAITLGKMVIHMLKFPCLRVLKHVVRCYLLLTENARARSALRVCLPDLLRDGTFTS 260
            |:.::|||.||:.|||||:.:.|.|..|:|||||||||.|::|.|||.|||.||||.|:|.||..
 Frog   200 CQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQ 264

  Fly   261 LVQHDTCTKQWLQMLLKNLQTNAV-NPMG 288
            :::.||.||:||..|:||||...| :|.|
 Frog   265 VLKDDTTTKRWLAQLVKNLQEGQVTDPRG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 154/248 (62%)
cnot9NP_989024.1 Rcd1 25..283 CDD:367798 158/257 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.