DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and Rcd-1

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_608335.1 Gene:Rcd-1 / 32966 FlyBaseID:FBgn0031047 Length:304 Species:Drosophila melanogaster


Alignment Length:304 Identity:199/304 - (65%)
Similarity:232/304 - (76%) Gaps:15/304 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAEPSPVMSP---------QQQAEREKVYQLIIELAYPATRETALLELSKNTYADLAPMLWKSV 56
            |||:|||.|:|         |||.|:|||||.|.|||:|.|||||||||||....|||||||.|.
  Fly     1 MSAQPSPHMNPQQQQQQQQQQQQTEQEKVYQWINELAHPDTRETALLELSKKRETDLAPMLWNSF 65

  Fly    57 GTTCTLLQEIVNIYPIITTPVLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLST 121
            ||.|.||||||||||.||.|.|.|:||||||.||.||||||||||||.|||:.|||:||||||||
  Fly    66 GTACALLQEIVNIYPSITPPTLTAHQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLST 130

  Fly   122 TFKSRPFEQLRLTTLGVINALAETGDTEVLIFLIWSEVVPHCLTNMVRGSKLTKIAATSILEKIL 186
            |.|:||||.||||:||||.||.:|.:.||:.||:.:|:||.||:.|..||:|:|..||.|::|||
  Fly   131 TSKTRPFEYLRLTSLGVIGALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKIL 195

  Fly   187 LDEMGLTYICENHDRFSQVAITLGKMVIHMLKFPCLRVLKHVVRCYLLLTENARARSALRVCLPD 251
            |||.||:|||:.::|||.||||||||||.:.|.||.|:|||||||||.|::|.|||.||..||||
  Fly   196 LDESGLSYICQTYERFSHVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPD 260

  Fly   252 LLRDGTFTSLVQHDTCTKQWLQMLLKNLQTNA------VNPMGS 289
            .||||||...:|.|..||||||||||||:..|      ::|:||
  Fly   261 QLRDGTFALCLQEDKSTKQWLQMLLKNLELGATPQQIGMSPLGS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 171/246 (70%)
Rcd-1NP_608335.1 Rcd1 40..288 CDD:281998 171/247 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464274
Domainoid 1 1.000 337 1.000 Domainoid score I588
eggNOG 1 0.900 - - E1_COG5209
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I597
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 1 1.000 - - mtm1000
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2622
109.900

Return to query results.
Submit another query.