DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and Cnot9

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038939282.1 Gene:Cnot9 / 301513 RGDID:1311495 Length:300 Species:Rattus norvegicus


Alignment Length:290 Identity:173/290 - (59%)
Similarity:212/290 - (73%) Gaps:4/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEPSPVMSPQQQAEREKVYQLIIELAYPATRETALLELSK--NTYADLAPMLWKSVGTTCTLLQE 65
            |..:||.:...|.:|||:||.|.||:.|.|||.|||||||  .:..|||||||.|.||...||||
  Rat     5 ATAAPVPTALAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQE 69

  Fly    66 IVNIYPIITTPVLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLSTTFKSRPFEQ 130
            ||||||.|..|.|.|:||||||.||.||||||||||||.|||...||::|||||.|..|:||||.
  Rat    70 IVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEY 134

  Fly   131 LRLTTLGVINALAETGDTEVLIFLIWSEVVPHCLTNMVRGSKLTKIAATSILEKILLDEMGLTYI 195
            ||||:||||.||.:|.:.||:.||:.:|::|.||..|..||:|:|..||.||:|||||:.||.||
  Rat   135 LRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYI 199

  Fly   196 CENHDRFSQVAITLGKMVIHMLKFPCLRVLKHVVRCYLLLTEN-ARARSALRVCLPDLLRDGTFT 259
            |:.::|||.||:.|||||:.:.|.|..|:|||||||||.|::| :|||.|||.||||.|:|.||.
  Rat   200 CQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPSRAREALRQCLPDQLKDTTFA 264

  Fly   260 SLVQHDTCTKQWLQMLLKNLQTNAV-NPMG 288
            .:::.||.||:||..|:||||...| :|.|
  Rat   265 QVLKDDTTTKRWLAQLVKNLQEGQVTDPRG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 154/249 (62%)
Cnot9XP_038939282.1 Rcd1 25..284 CDD:397961 158/258 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.