DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1r and ntl-9

DIOPT Version :9

Sequence 1:NP_609269.1 Gene:Rcd-1r / 34229 FlyBaseID:FBgn0032089 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001309488.1 Gene:ntl-9 / 175669 WormBaseID:WBGene00016139 Length:330 Species:Caenorhabditis elegans


Alignment Length:313 Identity:151/313 - (48%)
Similarity:191/313 - (61%) Gaps:35/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEPSPVMSPQQQA---------EREKVYQLIIELAYPATRETALLELSK--NTYADLAPMLWKSV 56
            |..||....||.|         ..:::.|.||:|..|..||.|||||||  ::..||...||.|.
 Worm     4 ARASPATQAQQTAVPSSANLDINTDEIMQWIIDLRDPPKREAALLELSKKRDSVPDLPIWLWHSF 68

  Fly    57 GTTCTLLQEIVNIYPIITTPVLKANQSNRVCYALTLLQCVASHPETRPAFLRDQIPMYLYPFLST 121
            ||...||||:|.|||.|....|.|.||||||.||.|:||||||.:||..||...||:||||||.|
 Worm    69 GTMSALLQEVVAIYPAIMPANLTAAQSNRVCNALALMQCVASHRDTRGPFLHAHIPLYLYPFLHT 133

  Fly   122 TFKSRPFEQLRLTTLGVINALAETGDTEVLI----FLIWSEVVPHCLTNMVRGSKLTKIAATSIL 182
            |..||.||.||||:||||.||.:|.|.|.|:    ||:.:|::|.||..|.:|::|:|..||.||
 Worm   134 TKVSRSFEYLRLTSLGVIGALVKTDDKEQLLIVINFLLSTEIIPLCLRIMEQGTELSKTVATFIL 198

  Fly   183 EKILLDEMGLTYICENHDRFSQVAITLGKMVIHMLKFPCLRVLKHVVRCYLLLTEN--------- 238
            :|||||:.||.|||:.::|||.|.:.|||||:.:.:.|.:|:||||||||..|::|         
 Worm   199 QKILLDDTGLLYICQTYERFSHVVLILGKMVMKLTREPSVRLLKHVVRCYSRLSDNPTLTIDAPR 263

  Fly   239 -----------ARARSALRVCLPDLLRDGTFTSLVQHDTCTKQWLQMLLKNLQ 280
                       .||..||:.||||.|:|.||.||::.|..|..||:.||..|:
 Worm   264 GQGAAPGQIVKMRASLALKQCLPDQLKDLTFKSLLKEDPSTMNWLRQLLTTLE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1rNP_609269.1 Rcd1 32..279 CDD:281998 139/272 (51%)
ntl-9NP_001309488.1 Rcd1 42..315 CDD:281998 139/272 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 337 1.000 Domainoid score I588
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I1344
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53719
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 1 1.000 - - FOG0003765
OrthoInspector 1 1.000 - - otm14698
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.