powered by:
Protein Alignment CG13102 and XB5967085
DIOPT Version :9
Sequence 1: | NP_001245948.1 |
Gene: | CG13102 / 34228 |
FlyBaseID: | FBgn0032088 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001037878.1 |
Gene: | XB5967085 / 733461 |
XenbaseID: | XB-GENE-5967086 |
Length: | 115 |
Species: | Xenopus tropicalis |
Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
Similarity: | 25/47 - (53%) |
Gaps: | 7/47 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 MKALIVSILVAF-VCVQI-----ADSLKCYTC-VTPKDCKSPKKVTC 42
||.|:..::|.. |.:|: |..|:||:| ..|.:|...|.:||
Frog 1 MKLLVALLIVLLSVLLQVTKPATAQGLQCYSCNAPPPNCYKKKIITC 47
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1592016at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.