powered by:
Protein Alignment CG13102 and Slurp1
DIOPT Version :9
Sequence 1: | NP_001245948.1 |
Gene: | CG13102 / 34228 |
FlyBaseID: | FBgn0032088 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_065265.1 |
Gene: | Slurp1 / 57277 |
MGIID: | 1930923 |
Length: | 110 |
Species: | Mus musculus |
Alignment Length: | 124 |
Identity: | 27/124 - (21%) |
Similarity: | 41/124 - (33%) |
Gaps: | 34/124 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 ILVAFVCVQIADSLKCYTCVTP---KDCKSPKKVTCTNAAAN---ETSYYLGVYHQNVGNLTSTR 68
:|:|...:...::.:||||..| ..||:..:....:.|.. ||......::.:.....|..
Mouse 10 LLLAAWSMGYGEAFRCYTCEQPTAINSCKNIAQCKMEDTACKTVLETVEAAFPFNHSPMVTRSCS 74
Fly 69 FDCLALKYNWNNDVIHQLHGCVHPNVGACSLALKPAYAHYNKTWCLTCSGDKCNKNPAG 127
..|||. :.|.| |..|| .:| |..|.||....|
Mouse 75 SSCLAT----DPDGI----GVAHP------------------VFC--CFRDLCNSGFPG 105
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13102 | NP_001245948.1 |
None |
Slurp1 | NP_065265.1 |
LU |
24..102 |
CDD:238065 |
24/105 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1592016at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.