DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13102 and RGD1565410

DIOPT Version :9

Sequence 1:NP_001245948.1 Gene:CG13102 / 34228 FlyBaseID:FBgn0032088 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_038935702.1 Gene:RGD1565410 / 503162 RGDID:1565410 Length:163 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:54/155 - (34%) Gaps:45/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MKALIVSILVAFVCVQIADSLKCYTCVTPKDCKSPKKVTCTNAAANETSYYLGVYHQNVGNLTST 67
            ||:.::...:|.:|.:.|..|.||.|:.     .|...||:.|..   .|..||.   |..:...
  Rat    36 MKSCVLIFFLALLCAERAQGLTCYNCIA-----VPLNTTCSTATC---PYSDGVC---VSQVVEA 89

  Fly    68 RFDCLALKYNWNNDVIHQLHGCVHPNVGACSLALKPAYAH---------YNKTWCLTCSGDKCNK 123
            ..|.:..|...|    ..|.||             |.:..         |.|..|  |:.|.|  
  Rat    90 VKDSVKGKAKSN----LCLPGC-------------PKFPQRTEILGTVVYTKISC--CNTDFC-- 133

  Fly   124 NPAGKMSSSTIAIASSVLGLLLVKM 148
            |.||....||..:|    |:||..:
  Rat   134 NAAGPTGGSTWTMA----GVLLFSL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13102NP_001245948.1 None
RGD1565410XP_038935702.1 LU 56..140 CDD:214530 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.