DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13102 and Slurp1

DIOPT Version :9

Sequence 1:NP_001245948.1 Gene:CG13102 / 34228 FlyBaseID:FBgn0032088 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001124016.1 Gene:Slurp1 / 300016 RGDID:1308768 Length:110 Species:Rattus norvegicus


Alignment Length:131 Identity:26/131 - (19%)
Similarity:49/131 - (37%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYMKALIVSILVAFVCVQIADSLKCYTCVTPKDCKSPKKVTCTNAAANETSYYLGVYHQNVGNLT 65
            |.::..:..:|:|...:...::.:||||..|         |..|:..|       :.|..:.:..
  Rat     1 MTLRWAVWLLLLAAWSMGYGEAFRCYTCEQP---------TAINSCKN-------IVHCKLEDTA 49

  Fly    66 -STRFDCLALKYNWNNDVIHQLHGCVHPNVGACSLALKP---AYAHYNKTWCLTCSGDKCNKNPA 126
             .|..:.:..::.:|:..:      |..:..:..||..|   ..||  ..:|  |..|.||....
  Rat    50 CKTVLETVEAEFPFNHSPM------VTRSCSSSCLATDPDGIGVAH--PVFC--CFRDLCNSGFP 104

  Fly   127 G 127
            |
  Rat   105 G 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13102NP_001245948.1 None
Slurp1NP_001124016.1 LU 24..102 CDD:238065 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.