DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13102 and tag-234

DIOPT Version :9

Sequence 1:NP_001245948.1 Gene:CG13102 / 34228 FlyBaseID:FBgn0032088 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001379983.1 Gene:tag-234 / 173996 WormBaseID:WBGene00018874 Length:111 Species:Caenorhabditis elegans


Alignment Length:159 Identity:39/159 - (24%)
Similarity:56/159 - (35%) Gaps:63/159 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYMKALIVSILVAFVCVQIADSLKCYTCVTPKDCKSPKKVTCTNAAANETSYYLGVYHQNVGNLT 65
            |..|.|.:::|:..|.|  |.||:||                              |.|.|...|
 Worm     1 MSSKLLFLAVLLTVVTV--AYSLQCY------------------------------YGQIVNGQT 33

  Fly    66 STRF---DCLALKY--------NWNNDVIHQLHGCVHPNVGACSLA----LKPAYAHYNKTWCLT 115
            :..|   .|...||        ::||  |:..:||   ....||.:    .|..|.    |.|  
 Worm    34 TVPFVSEPCPFSKYCMKIFQTGSYNN--IYATYGC---GTNQCSSSGCSTNKNGYG----TCC-- 87

  Fly   116 CSGDKCNKNPAGKMSSSTIAIASSVLGLL 144
            |:.|.||.  ....|.:|:   ||::.:|
 Worm    88 CTRDLCNS--GFDFSKTTL---SSIVQIL 111



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.