DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9568 and XB5967085

DIOPT Version :9

Sequence 1:NP_609267.1 Gene:CG9568 / 34227 FlyBaseID:FBgn0032087 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001037878.1 Gene:XB5967085 / 733461 XenbaseID:XB-GENE-5967086 Length:115 Species:Xenopus tropicalis


Alignment Length:132 Identity:24/132 - (18%)
Similarity:31/132 - (23%) Gaps:61/132 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIFCVVLVAFVVVPFANSLTCSKCTS-PSGCK-------SPSSETCSNSTA---------NANKE 52
            |:...||:.......|..|.|..|.: |..|.       .|..:.|..:|.         |...|
 Frog     9 IVLLSVLLQVTKPATAQGLQCYSCNAPPPNCYKKKIITCEPGQDRCVKTTTKIVDYDGSPNEKNE 73

  Fly    53 F------------------LEGYHSNVPTVNGSLSFSCANLTYYHAANYTHTFEFLGCVFNETNV 99
            |                  .|.|.......|    .:|.|                      ||:
 Frog    74 FDKFMNVLVWERVCMTAKECEAYKQRTKIRN----VTCCN----------------------TNL 112

  Fly   100 CN 101
            ||
 Frog   113 CN 114



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.