DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9568 and Ly6i

DIOPT Version :9

Sequence 1:NP_609267.1 Gene:CG9568 / 34227 FlyBaseID:FBgn0032087 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001344934.1 Gene:Ly6i / 57248 MGIID:1888480 Length:134 Species:Mus musculus


Alignment Length:106 Identity:21/106 - (19%)
Similarity:31/106 - (29%) Gaps:34/106 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VPFANSLTCSKCTSPSG-CKSPSSETCSNSTANANKEFLEGYHSNVP---------TVNGSLSFS 71
            |||..|.....|..|.| |.:...|..:||.....|.  ...|...|         ..|..::.|
Mouse    35 VPFETSCPSFTCPYPDGFCVAQEEEFIANSQRKKVKS--RSCHPFCPDEIEKKFILDPNTKMNIS 97

  Fly    72 CANLTYYHAANYTHTFEFLGCVFNETNVCNLSLNNTASGWS 112
            |.                      :.::||.::....|.|:
Mouse    98 CC----------------------QEDLCNAAVPTGGSSWT 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9568NP_609267.1 None
Ly6iNP_001344934.1 UPAR_LY6 29..105 CDD:333773 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.