DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9568 and RGD1565410

DIOPT Version :9

Sequence 1:NP_609267.1 Gene:CG9568 / 34227 FlyBaseID:FBgn0032087 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_038935702.1 Gene:RGD1565410 / 503162 RGDID:1565410 Length:163 Species:Rattus norvegicus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:56/151 - (37%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CVVL--VAFVVVPFANSLTCSKCTSPSGCKSPSSETCSNSTANANKEFLEG--YHSNVPTVNGSL 68
            ||::  :|.:....|..|||..|.:     .|.:.|||.:|.    .:.:|  ....|..|..|:
  Rat    39 CVLIFFLALLCAERAQGLTCYNCIA-----VPLNTTCSTATC----PYSDGVCVSQVVEAVKDSV 94

  Fly    69 SFSC-ANLTYYHAANYTHTFEFLGCVFNETNVCNLSLNNTASGWSKKCLQCGTDYCNPAGTYSSS 132
            .... :||.......:....|.||.|......|                 |.||:||.||....|
  Rat    95 KGKAKSNLCLPGCPKFPQRTEILGTVVYTKISC-----------------CNTDFCNAAGPTGGS 142

  Fly   133 VYTIVG----SAIAVILAKVL 149
            .:|:.|    |..:|:|..:|
  Rat   143 TWTMAGVLLFSLGSVLLQTLL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9568NP_609267.1 None
RGD1565410XP_038935702.1 LU 56..140 CDD:214530 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.