DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9568 and CG13102

DIOPT Version :9

Sequence 1:NP_609267.1 Gene:CG9568 / 34227 FlyBaseID:FBgn0032087 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001245948.1 Gene:CG13102 / 34228 FlyBaseID:FBgn0032088 Length:150 Species:Drosophila melanogaster


Alignment Length:151 Identity:57/151 - (37%)
Similarity:77/151 - (50%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWKKIIFCVVLVAFVVVPFANSLTCSKCTSPSGCKSPSSETCSNSTANANKEFLEGYHSNVPTVN 65
            |:.|.:...:|||||.|..|:||.|..|.:|..||||...||:|:.||....:|..||.||..:.
  Fly     1 MYMKALIVSILVAFVCVQIADSLKCYTCVTPKDCKSPKKVTCTNAAANETSYYLGVYHQNVGNLT 65

  Fly    66 GSLSFSCANLTYYHAANYTHTFEFLGCVFNETNVCNLSLNNTASGWSKK-CLQCGTDYC--NPAG 127
             |..|.|..|.|....:..|  :..|||......|:|:|....:.::|. ||.|..|.|  ||||
  Fly    66 -STRFDCLALKYNWNNDVIH--QLHGCVHPNVGACSLALKPAYAHYNKTWCLTCSGDKCNKNPAG 127

  Fly   128 TYSSSVYTIVGSAIAVILAKV 148
            ..|||...|..|.:.::|.|:
  Fly   128 KMSSSTIAIASSVLGLLLVKM 148



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592016at2759
OrthoFinder 1 1.000 - - FOG0019614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.