powered by:
Protein Alignment CG9568 and XB5836725
DIOPT Version :9
Sequence 1: | NP_609267.1 |
Gene: | CG9568 / 34227 |
FlyBaseID: | FBgn0032087 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941735.1 |
Gene: | XB5836725 / 100493076 |
XenbaseID: | XB-GENE-5836726 |
Length: | 102 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 23/68 - (33%) |
Similarity: | 29/68 - (42%) |
Gaps: | 17/68 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KKIIFCVVLVAFVVVPFANS----LTCSKCTSPSGCK-------SPSSETCSNS-----TANANK 51
|.||.|.|||. |::..|.| |.|..|:.|:.|. .|..:||..| ..:|.|
Frog 2 KLIILCAVLVT-VLLHEAESAKKPLECHSCSLPNDCLKQKTDVCGPGQDTCQRSHTVKYDKDAPK 65
Fly 52 EFL 54
|.|
Frog 66 EIL 68
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1592016at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.