DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss36

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:288 Identity:95/288 - (32%)
Similarity:128/288 - (44%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HLFIGGILLV----------------------NLSLGATVRRPRLDGRIVGGQVANIKDIPYQVS 58
            |||:..:::|                      :|..|    ||....|||||..|:....|:|||
Mouse     4 HLFLPVVIMVVSPIPPGAFQDSVVSPTQGEFEDLDCG----RPEPSSRIVGGSDAHPGTWPWQVS 64

  Fly    59 L-QRSYHFCGGSLIAQGWVLTAAHC--TEGSAILLSKVRIGSSRTSVGGQLVG-----IKRVHRH 115
            | |...|.|||||||..|||:||||  |.|:.....::.:.....|..|.|.|     :..:...
Mouse    65 LHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIP 129

  Fly   116 PKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSA--VL 178
            ..:....:..|.:||.|...:....:...|.||......|.||....:|||:.|.|.....  ||
Mouse   130 DNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFAHGTACWATGWGDVQEAVPLPLPWVL 194

  Fly   179 RSVTVPKVSQTQCTEAYGNFG------SITDRMLCAGLPEGGKDACQGDSGGPLAA-DGVLW--- 233
            :.|.:..:.:..|...|...|      .:...|||||.|.|.:|.|||||||||.. ||..|   
Mouse   195 QEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLA 259

  Fly   234 GVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |:.|:|:||.|.|.|||::.|:....||
Mouse   260 GITSFGFGCGRRNRPGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 85/239 (36%)
Tryp_SPc 42..264 CDD:238113 86/240 (36%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 86/240 (36%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.