DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss22

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:284 Identity:95/284 - (33%)
Similarity:139/284 - (48%) Gaps:43/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGG------ILLVNLS-----LGATVR------RPRLDGRIVGGQVANIKDIPYQVS-LQRSYHF 65
            :||      ||||.|:     ..||:|      :|:...|||||:.:.....|:.|| |:...|.
Mouse    68 LGGDQFSILILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHH 132

  Fly    66 CGGSLIAQGWVLTAAHCTEGS-------AILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFD-AYT 122
            |.|||:...||:|||||.:.:       ::||...::||  .....|.|||..|..||::. ...
Mouse   133 CAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGS--PGPRSQKVGIAWVLPHPRYSWKEG 195

  Fly   123 IDFDFSLLELE---EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQET--SAVLRSVT 182
            ...|.:|:.||   ::|.:.:.   :.||:....:...|...::|||:.|.....  ...|:.:.
Mouse   196 THADIALVRLEHSIQFSERILP---ICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLK 257

  Fly   183 VPKVSQTQCTEAY---GNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD----GVLWGVVSWGY 240
            ||.:....|...|   ....:||:.|||||..||.:|||.|||||||...    .:|.|::|||.
Mouse   258 VPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGE 322

  Fly   241 GCARPNYPGVYSRVSAVRDWISSV 264
            |||..|.||||:.:.|.|.|:..:
Mouse   323 GCAERNRPGVYTSLLAHRSWVQRI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 83/240 (35%)
Tryp_SPc 42..264 CDD:238113 83/242 (34%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.