DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss37

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_080593.1 Gene:Prss37 / 67690 MGIID:1914940 Length:237 Species:Mus musculus


Alignment Length:238 Identity:46/238 - (19%)
Similarity:87/238 - (36%) Gaps:59/238 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYQVSLQRSYHFCGGSLIAQGWVLTAAHC-TEGSAILL----SKVRIGSSRTSVGGQLVGIKRVH 113
            ||...|:.:::.|.|.||...|||..:|| .....::|    |:||.|:.:|....|::      
Mouse    28 PYLAYLKSNFNPCVGVLIKASWVLAPSHCYLPNLRVMLGNFKSRVRDGTEQTIYPIQII------ 86

  Fly   114 RHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSG--WGNTQSAQETSA 176
            |:..:.......|..|::|.:.:..|  .....||....::..||...:||  |....:.:... 
Mouse    87 RYWNYSHTAPQDDLMLIKLAKPATFN--HKVQVLPIATTNVRPGTVCTLSGLDWSQENNGRHPD- 148

  Fly   177 VLRSVTVPKVSQTQCTE-----AYGN-------------FGSI-TDRMLCAGLPEGGKDACQGDS 222
            :.:::..|.::...|.:     ::.|             ||.: ...::|       |:..||..
Mouse   149 LRQNLEAPVMTDKDCQKTQQGSSHRNSLCVRFVKVFSRIFGEVAVATVIC-------KNKLQGIE 206

  Fly   223 GGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSVS 265
            .|......|                 |:|:.:.:...||...:
Mouse   207 VGHFMGGDV-----------------GIYTNIYSYVPWIEKTT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 44/232 (19%)
Tryp_SPc 42..264 CDD:238113 46/235 (20%)
Prss37NP_080593.1 Tryp_SPc 28..231 CDD:389826 46/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.