DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prss1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:227 Identity:97/227 - (42%)
Similarity:130/227 - (57%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSV- 102
            |.:||||.......:||||||...|||||||||:..||::||||.:...    :||:|.....| 
Zfish    22 DDKIVGGYECTKNGVPYQVSLNSGYHFCGGSLISNLWVVSAAHCYKSRV----QVRLGEHNIDVT 82

  Fly   103 --GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165
              ..|.:..::|.|||.:::.|:|.|..|::|...:..|.....|.||...|  :.||..|:|||
Zfish    83 EGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSSCA--SSGTSCLISGW 145

  Fly   166 GN-TQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD 229
            || :.|.....:.|..:..|.:|.:.|..||.  |.|:..|.|||..|||||:||||||||:..:
Zfish   146 GNMSASGSNYPSRLMCLNAPILSDSTCRNAYP--GQISSNMFCAGFMEGGKDSCQGDSGGPVVCN 208

  Fly   230 GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ..|.|:||||||||:.|.||||::|.....||
Zfish   209 NQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 94/223 (42%)
Tryp_SPc 42..264 CDD:238113 96/224 (43%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 94/223 (42%)
Tryp_SPc 25..243 CDD:238113 96/224 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134055
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10390
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.