DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS22

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:286 Identity:97/286 - (33%)
Similarity:145/286 - (50%) Gaps:37/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLTGMAKTILHLFIGGIL-LVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGG 68
            |..|...::|.|....|| ...:.:.....:|:...|:|||:.:...:.|:.||:|:: .|.|.|
Human    13 GCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAG 77

  Fly    69 SLIAQGWVLTAAHCTEGS-------AILLSKVRIGS--SRTSVGGQLVGIKRVHRHP----KFDA 120
            ||:...||:|||||.:.:       ::||...::|:  ||:    |.||:..|..||    |..|
Human    78 SLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRS----QKVGVAWVEPHPVYSWKEGA 138

  Fly   121 YTIDFDFSLLELE---EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQET--SAVLRS 180
            ..   |.:|:.||   ::|.:.:.   :.||:....:...|...:||||:.|.....  ...|:.
Human   139 CA---DIALVRLERSIQFSERVLP---ICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQK 197

  Fly   181 VTVPKVSQTQCTEAY---GNFGSITDRMLCAGLPEGGKDACQGDSGGPL--AADG--VLWGVVSW 238
            :.||.:....|:..|   ...|.||:.|||||..||.:|||.|||||||  ..||  :|.|::||
Human   198 LKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISW 262

  Fly   239 GYGCARPNYPGVYSRVSAVRDWISSV 264
            |.|||..|.||||..:||.|.|:..:
Human   263 GEGCAERNRPGVYISLSAHRSWVEKI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 89/245 (36%)
Tryp_SPc 42..264 CDD:238113 89/247 (36%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 89/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.