DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG17234

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:271 Identity:85/271 - (31%)
Similarity:130/271 - (47%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLV----NLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSY---HFCGGSLIAQG 74
            :||...||:    .||.|..   .|.:.||:||:...|:.:|:|||||  |   |.||||:.::.
  Fly     1 MFIESFLLLLALDFLSAGQV---NRWEQRIIGGEPIGIEQVPWQVSLQ--YFGDHVCGGSIYSEN 60

  Fly    75 WVLTAAHC---TEGSAI--LLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDF-DFSLLELE 133
            .::|||||   .||:.:  ...:||.||:.|...|.||.:..:..|.:: |:.::. |.:::.|.
  Fly    61 IIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLS 124

  Fly   134 ---EYSAKNVTQAFVGLPEQDADIADGTP-----VLVSGWGNTQSAQETSAV----LRSVTVPKV 186
               |:::|          .|...:|...|     .||||||.:....:::.:    |:.:.:...
  Fly   125 TPLEFTSK----------VQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIK 179

  Fly   187 SQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGV 250
            |...|.       .....:||||  ..|:.||.|||||||..:..|.|||||| .||....:   
  Fly   180 SIFSCR-------LFDPSLLCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF--- 232

  Fly   251 YSRVSAVRDWI 261
            :..|...|:||
  Fly   233 FVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 75/241 (31%)
Tryp_SPc 42..264 CDD:238113 76/242 (31%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/241 (31%)
Tryp_SPc 27..243 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.