DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk4

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:261 Identity:79/261 - (30%)
Similarity:123/261 - (47%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQG 74
            |:|....|:|.::|......|:    .:..||:.||..:....|:|.:| .....||.|.|:...
Mouse     5 ARTPWGWFLGCLILEVTGASAS----SVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQ 65

  Fly    75 WVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVH-----RHPKFDAYTIDFDFSLLELEE 134
            |||:||||.:.|.|    |.:|..... |.|..|.:.:.     :||.|:..:...|..|::|.|
Mouse    66 WVLSAAHCLQESYI----VGLGLHNLK-GSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNE 125

  Fly   135 YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199
            ...::.|  ...:|........|...||||||..::.:..| :|:.|.:...|:..|...|....
Mouse   126 SVIESNT--IRSIPVATQCPTPGDTCLVSGWGQLKNGKLPS-LLQCVNLSVASEETCRLLYDPVY 187

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYG-CARPNYPGVYSRVSAVRDWISS 263
            .::  |.|||..:..||:|.||||||:..:..|.|:||.|.| |.:|..|.||:.:....:||.:
Mouse   188 HLS--MFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQT 250

  Fly   264 V 264
            :
Mouse   251 I 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 71/226 (31%)
Tryp_SPc 42..264 CDD:238113 72/228 (32%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.