DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRTN3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:83/255 - (32%)
Similarity:114/255 - (44%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR----SYHFCGGSLIAQGWVLTA 79
            :..:||..|..||.     ....||||..|.....||..|||.    ..|||||:||...:||||
Human    10 LASVLLALLLSGAA-----RAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTA 69

  Fly    80 AHCTEGSAILLSKVRIGSS--RTSVGGQL-VGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVT 141
            |||.......|..|.:|:.  ||....|. ..:.:|..: .:||.....|..|::|...:..:.:
Human    70 AHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLN-NYDAENKLNDVLLIQLSSPANLSAS 133

  Fly   142 QAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRML 206
            .|.|.||:||..:..||..|..|||...:....:.||:.:.|..|: ..|          ....:
Human   134 VATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVT-FFC----------RPHNI 187

  Fly   207 CAGLPEGGKDACQGDSGGPLAADGVLWGV---VSWGYGCARPNYPGVYSRVSAVRDWISS 263
            |..:|......|.|||||||..||::.|:   |.|  |||...:|..::||:...|||.|
Human   188 CTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFTRVALYVDWIRS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 75/229 (33%)
Tryp_SPc 42..264 CDD:238113 78/232 (34%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.