DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK10

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:284 Identity:91/284 - (32%)
Similarity:129/284 - (45%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSSIGLTGMAKTILHLFIGGILLVNLSLGATVRRP----RLDGRIVGGQVANIKDIPYQVSLQR 61
            :.::.|...:||.:      .:|:..|........|    |||....|...|.... |:||||..
Human     8 LSAASGARALAKLL------PLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQ-PWQVSLFN 65

  Fly    62 --SYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSV--GGQLVGIKRVHRHPKF---- 118
              |:| |.|.|:.|.||||||||  |:..|.:  |:|.....:  |.||....|...|||:    
Human    66 GLSFH-CAGVLVDQSWVLTAAHC--GNKPLWA--RVGDDHLLLLQGEQLRRTTRSVVHPKYHQGS 125

  Fly   119 ----DAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQ---ETSA 176
                ...|.:.|..||:|............:.||.:.|.  .|....|:|||.|.:.:   ....
Human   126 GPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQ--PGDQCQVAGWGTTAARRVKYNKGL 188

  Fly   177 VLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-Y 240
            ...|:|:  :|..:|...|.  |.:|:.|:|||| :.|:|.||.||||||..|..|.|::||| |
Human   189 TCSSITI--LSPKECEVFYP--GVVTNNMICAGL-DRGQDPCQSDSGGPLVCDETLQGILSWGVY 248

  Fly   241 GCARPNYPGVYSRVSAVRDWISSV 264
            .|....:|.||:::.....||:.|
Human   249 PCGSAQHPAVYTQICKYMSWINKV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 79/235 (34%)
Tryp_SPc 42..264 CDD:238113 81/237 (34%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 81/235 (34%)
Tryp_SPc 49..269 CDD:214473 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.