DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK6

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:243 Identity:91/243 - (37%)
Similarity:122/243 - (50%) Gaps:13/243 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYH-FCGGSLIAQGWVLTAAHCTEGS 86
            |:|.|||.|...... ..::|.|...:....|||.:|..|.| .|||.||...||||||||.:.:
Human     4 LMVVLSLIAAAWAEE-QNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPN 67

  Fly    87 -AILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP-E 149
             .:.|.|..:....:|  .:...:.|...||.:||.:.|.|..||.|.. .|| :::....|| |
Human    68 LQVFLGKHNLRQRESS--QEQSSVVRAVIHPDYDAASHDQDIMLLRLAR-PAK-LSELIQPLPLE 128

  Fly   150 QDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGG 214
            :|.. |:.|...:.|||.|... :....::...:..||:.:|..||.  |.||..|||||..:.|
Human   129 RDCS-ANTTSCHILGWGKTADG-DFPDTIQCAYIHLVSREECEHAYP--GQITQNMLCAGDEKYG 189

  Fly   215 KDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWI 261
            ||:|||||||||.....|.|:|||| ..|.....||||:.|....:||
Human   190 KDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 83/223 (37%)
Tryp_SPc 42..264 CDD:238113 85/224 (38%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 83/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.