DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:163 Identity:65/163 - (39%)
Similarity:86/163 - (52%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 HPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNT-QSAQETSAVL 178
            ||.::..|.:.|..|::|......|...:...||:|:..:..|....|||||:| .|.......|
Zfish    31 HPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMCRVSGWGSTSHSGGLIPLTL 95

  Fly   179 RSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDA---------------CQGDSGGPLAA 228
            |:|.:|.||..:|..:....|:||..|:|||...|||||               |||||||||..
Zfish    96 RTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLVC 160

  Fly   229 DGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ||.::|:||||.||..|.:||||:.||..|.||
Zfish   161 DGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 63/161 (39%)
Tryp_SPc 42..264 CDD:238113 65/163 (40%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 65/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.