DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:227 Identity:96/227 - (42%)
Similarity:131/227 - (57%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSV- 102
            |.:||||.......:||||||....||||||||::.||::||||.:...    :||:|.....| 
Human   107 DDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRI----QVRLGEHNIKVL 167

  Fly   103 --GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165
              ..|.:...::.||||::..|:|.|..|::|...:..|...:.:.||....  |.||..|:|||
Human   168 EGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPP--AAGTECLISGW 230

  Fly   166 GNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD 229
            |||.| ..:....|:.:..|.::|.:|..:|.  |.||:.|.|.|..|||||:||.|||||:..:
Human   231 GNTLSFGADYPDELKCLDAPVLTQAECKASYP--GKITNSMFCVGFLEGGKDSCQRDSGGPVVCN 293

  Fly   230 GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |.|.||||||:|||..|.||||::|....|||
Human   294 GQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/223 (42%)
Tryp_SPc 42..264 CDD:238113 95/224 (42%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 93/223 (42%)
Tryp_SPc 110..328 CDD:238113 95/224 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3308
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3865
Isobase 1 0.950 - 0 Normalized mean entropy S4506
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.