DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:256 Identity:109/256 - (42%)
Similarity:150/256 - (58%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRP-RLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEG 85
            :||:...:.|.|..| ..|.:||||.:.....:||||||...|||||||||::.||::|.||.: 
Human     3 LLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYK- 66

  Fly    86 SAI--LLS---------KVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYS 136
            |||  .||         :||:|.....|   ..|.:...::.||||:::.|:|.|..|::|...:
Human    67 SAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPA 131

  Fly   137 AKNVTQAFVGLPEQDADIADGTPVLVSGWGNT-QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGS 200
            ..|...:.:.||  .|..|.||..|:|||||| .|..:....|:.:..|.:||.:|..:|.  |.
Human   132 VINSRVSAISLP--TAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYP--GK 192

  Fly   201 ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ||:.|.|.|..|||||:||||||||:.::|.|.|:||||||||:.|.||||::|....|||
Human   193 ITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 101/234 (43%)
Tryp_SPc 42..264 CDD:238113 103/235 (44%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 101/234 (43%)
Tryp_SPc 24..256 CDD:238113 103/235 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3308
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3865
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.