DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and si:dkey-78l4.2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_003201096.2 Gene:si:dkey-78l4.2 / 561111 ZFINID:ZDB-GENE-060503-647 Length:255 Species:Danio rerio


Alignment Length:231 Identity:73/231 - (31%)
Similarity:107/231 - (46%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQ 105
            |..|..|.....||.||||: |.|.|||.||.:.:|||||||.:...::  .|.:|:...| |.:
Zfish    26 IEDGTKAKPHSRPYMVSLQKNSRHSCGGFLITEQFVLTAAHCWKKGDVI--TVGVGAHDLS-GNE 87

  Fly   106 LVGIKRVHR---HPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGN 167
            :.....|..   ||::...:...|..||:|.:....:.....:.||:...|:.......|:|||.
Zfish    88 IYDTFEVTSYIPHPEYKLNSDRNDIMLLKLNKKVRLSYNVGLISLPKDGEDVEADILCSVAGWGR 152

  Fly   168 TQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVL 232
            ......:...||......|:..:| |...|......:|:|| ...||  :|.|||||||..:...
Zfish   153 LWLKGPSPDRLREAETVIVNDAEC-ERRWNKTYKASKMICA-YGHGG--SCSGDSGGPLVCNNTA 213

  Fly   233 WGVVSWG--YGCARPNYPGVYSRVSAVRDWISSVSG 266
            .|:.|:.  |.|.....|.||:|:||...||.:::|
Zfish   214 VGITSFSDRYLCNSRLLPNVYTRISAYLPWIHNITG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 70/224 (31%)
Tryp_SPc 42..264 CDD:238113 72/227 (32%)
si:dkey-78l4.2XP_003201096.2 Tryp_SPc 26..247 CDD:238113 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.