DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:252 Identity:110/252 - (43%)
Similarity:148/252 - (58%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTE 84
            :|.|.|.:.|...:..:..|||||.|.....|.|.||:|.:  .|||||:||.:.||||||||..
Zfish     7 LLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAAHCNI 71

  Fly    85 GSAILLSKVRIGSSRTSVGGQLVGIKRVHR------HPKFDAYTIDFDFSLLELEEYSAKNVTQA 143
            |.|    .:||.:...|| |...|:::..|      ||::|..|.:.|..|::|:.....|...:
Zfish    72 GEA----NMRIVAGDYSV-GLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYLNSYVS 131

  Fly   144 FVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQC--TEAYGNFGSITDRML 206
            .|.||.|||.:|.|....|||||.|.|....|::||:|.:|.||...|  |:::.  |:||:.|:
Zfish   132 LVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTDSFN--GNITENMI 194

  Fly   207 CAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            |||...||||||:|||||||..:|.::|:||||.|||...|||||:.||..|.||.:
Zfish   195 CAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQWIDA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 104/229 (45%)
Tryp_SPc 42..264 CDD:238113 105/232 (45%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 104/229 (45%)
Tryp_SPc 27..252 CDD:238113 105/232 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.