DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC560023

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:262 Identity:104/262 - (39%)
Similarity:138/262 - (52%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIA 72
            |||:         :|.|.|.|...| |.....||:|||......|.|||||| ...|||||:||.
Zfish    21 GMAQ---------LLWVFLVLAVMV-RDAFSQRIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQ 75

  Fly    73 QGWVLTAAHCTEGSAILLSKVRIGSSRTSVG---GQLVGIKRVHRHPKFDAYTIDFDFSLLELEE 134
            ..||||||||...::::  :|.:.....:|.   .|:..:.:|..|..::..|.:.|..:::|  
Zfish    76 PQWVLTAAHCWRPASVI--QVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKTFNNDIMIIKL-- 136

  Fly   135 YSAKNVTQAFVG---LPEQDA-DIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCTEA 194
             :|.....|:|.   ||..|. ::|.|:...|||||.|:... ..|.:||:|.|...|..|....
Zfish   137 -TAPAQINAYVQPALLPTADTPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEIFSSCQLYYY 200

  Fly   195 YGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRD 259
            |    .:.|.|:|||...||||:|||||||||..||.|.|:||||.|||.|.|||||::|.....
Zfish   201 Y----RVNDNMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKVRNYNR 261

  Fly   260 WI 261
            ||
Zfish   262 WI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/228 (41%)
Tryp_SPc 42..264 CDD:238113 94/229 (41%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 93/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.