DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and si:dkey-21e2.16

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001038273.1 Gene:si:dkey-21e2.16 / 556598 ZFINID:ZDB-GENE-050208-698 Length:251 Species:Danio rerio


Alignment Length:265 Identity:78/265 - (29%)
Similarity:114/265 - (43%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNL--SLGATVRRPRLDGRIVG---GQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGW 75
            :.|..:|||:|  .|..|.|        ||   |..|.....||.|||| :.:|.||||||.:.:
Zfish     4 IIISLLLLVSLVPDLTYTAR--------VGIEDGTEAKPHSRPYMVSLQIKGWHICGGSLITEQF 60

  Fly    76 VLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHR--------HPKFDAYTIDFDFSLLEL 132
            |||||||.|...::  .|.:|:.      .|.|.|....        ||.:...:...|..||:|
Zfish    61 VLTAAHCWEKGDVI--TVVVGAH------DLSGNKTYDSFDVTSYIPHPDYKQSSYKNDILLLKL 117

  Fly   133 EEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGN 197
            .:....:.....:.||::..::...|...|:|||...........||......::..:|...: .
Zfish   118 NKKVTLSNNVGLISLPKEGENVEADTLCSVAGWGRLWVRGPRPGHLREADTVIMTDEECKRRW-E 181

  Fly   198 FGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSW--GYGCARPNYPGVYSRVSAVRDW 260
            ......:|:|. ...||  :|.|||||||.....:.||.|:  .|.|.....|.||:::||...|
Zfish   182 IKFKVSKMICV-YGHGG--SCSGDSGGPLVCGDTVVGVTSFTDRYLCNSRLRPNVYAKISAYIPW 243

  Fly   261 ISSVS 265
            |..::
Zfish   244 IKMIT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 68/233 (29%)
Tryp_SPc 42..264 CDD:238113 70/235 (30%)
si:dkey-21e2.16NP_001038273.1 Tryp_SPc 26..247 CDD:238113 68/232 (29%)
Tryp_SPc 26..244 CDD:214473 66/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.