DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK15

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:258 Identity:87/258 - (33%)
Similarity:126/258 - (48%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLS--LGATVRRPRLDG-RIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTAAHCT 83
            ||:.||  |.:|..:   || :::.|........|:||:| :|....||.|||:..|||:||||.
Human     3 LLLTLSFLLASTAAQ---DGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQ 64

  Fly    84 EGSAILLSKVRIG--SSRTSVG-GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFV 145
            .    ...:||:|  :.|...| .||....||..||:::|.:...|..||.|.:.:..|......
Human    65 S----RFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPA 125

  Fly   146 GLPEQDADIADGTPVLVSGW-----------GNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199
            .||.:...  .|...:||||           |:.:|.......|....:..:|.|.|.::|.  |
Human   126 VLPTRCPH--PGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYP--G 186

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWI 261
            .:|:.|:|||....|.::|:|||||||...|:|.|:|||| ..|.....||||::|....:||
Human   187 RLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 77/235 (33%)
Tryp_SPc 42..264 CDD:238113 79/236 (33%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.