DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prss1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:245 Identity:100/245 - (40%)
Similarity:143/245 - (58%) Gaps:13/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSA 87
            |:|.:.|||.|.... |.:||||.......:||||||...|||||||||...||::||||.:...
 Frog     4 LIVLVLLGAAVAFED-DDKIVGGFTCTKNAVPYQVSLNAGYHFCGGSLINSQWVVSAAHCYKSRI 67

  Fly    88 ILLSKVRIGSSRTSVG---GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPE 149
                :||:|....:|.   .|.:..::|.:||.:::..:|.|..|::|.  :...::.....:|.
 Frog    68 ----QVRLGEHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLS--TTARLSSNIQSVPL 126

  Fly   150 QDADIADGTPVLVSGWGNT-QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEG 213
            ..|..:.||..|:|||||| .|......:|:.:..|.::.::|:.:|.  |.||:.|.|||...|
 Frog   127 PSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSNSYP--GEITNNMFCAGFLAG 189

  Fly   214 GKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            |||:||||||||:..:|.|.||||||||||:.||||||::|.....||.:
 Frog   190 GKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/223 (41%)
Tryp_SPc 42..264 CDD:238113 93/226 (41%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 93/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134055
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.