DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tpsab1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:270 Identity:102/270 - (37%)
Similarity:134/270 - (49%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSL-------GATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS----YHFCGGSLIAQGW 75
            :||:.|.|       ..::..|| :| |||||.|:....|:||||:.:    .||||||||...|
  Rat    41 LLLLTLPLLSSLVHAAPSLAMPR-EG-IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQW 103

  Fly    76 VLTAAHCTEGSAILLSKVRIGSSRTSV--GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAK 138
            |||||||...:....:|:|:...:..:  ...|:.:.::..||.|.......|.:||:|.  :..
  Rat   104 VLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLT--NPV 166

  Fly   139 NVTQAF--VGLPEQDADIADGTPVLVSGWGNTQS--AQETSAVLRSVTVPKVSQTQCTEAY---- 195
            |:|...  |.||........||...|:||||..:  :......|..|.||.|....|...|    
  Rat   167 NITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGL 231

  Fly   196 ---GNFGSITDRMLCAGLPEGGKDACQGDSGGPLAA---DGVLW---GVVSWGYGCARPNYPGVY 251
               .|...:.|.|||||  ..|.|:|||||||||..   |  .|   ||||||.|||:||.||:|
  Rat   232 NTGDNVHIVRDDMLCAG--NEGHDSCQGDSGGPLVCKVED--TWLQAGVVSWGEGCAQPNRPGIY 292

  Fly   252 SRVSAVRDWI 261
            :||:...|||
  Rat   293 TRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/242 (38%)
Tryp_SPc 42..264 CDD:238113 95/243 (39%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 93/241 (39%)
Tryp_SPc 66..302 CDD:238113 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.