DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss53

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:312 Identity:78/312 - (25%)
Similarity:125/312 - (40%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNLSLGATVR----------RPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSL 70
            |.:|.::::. .|.|..|          .|: :|..:.|      :.|:|.|::| ..|.|.|||
  Rat    10 LIVGAVIVIE-GLQAAQRACGQRGPGPPEPQ-EGNTLPG------EWPWQASVRRQGVHICSGSL 66

  Fly    71 IAQGWVLTAAHCTE--GSAILLS-KVRIGSSR---TSVGGQLVGIKRVHRHPKFDAYTIDFDFSL 129
            :|..||||||||.|  .:|.|.| .|.:||.:   .|.|.:.||:..:.....::.|:...|.:|
  Rat    67 VADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLAL 131

  Fly   130 LELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW----------------------------- 165
            |:|    ...:....:.||:.......|.....:||                             
  Rat   132 LQL----THPIVHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLAL 192

  Fly   166 --------GNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNF------GSITDRMLCAGLPEGGKD 216
                    .:|.|....|..||::.:..:|:..|...|...      ......|||.|...|.:.
  Rat   193 CSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQG 257

  Fly   217 ACQGDSGGPLAA---DG--VLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            .||||||||:..   ||  |..|::|:...||:.:.|.:.:.::|...|:.:
  Rat   258 PCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWLQA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 70/274 (26%)
Tryp_SPc 42..264 CDD:238113 71/277 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 71/275 (26%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.