DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss33

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:275 Identity:104/275 - (37%)
Similarity:138/275 - (50%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HLFIGGILLVNLSLGATVR------RPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQ 73
            ||.|  :|||  .|||.::      :||:..|||||:.|...:.|:|.|:| |..|.|||||||.
  Rat     6 HLQI--LLLV--VLGARMQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAP 66

  Fly    74 GWVLTAAHC-------TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLE 131
            .|||||.||       :|.|.:|.:   :....||....||.:.||...|.:.......|.:||:
  Rat    67 QWVLTAGHCFSRRVLPSEYSVLLGA---LSLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQ 128

  Fly   132 LEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSA--QETSAVLRSVTVPKVSQTQCTEA 194
            |....:.:.....|.||...:....|:|..|:|||:....  ......|:.|.||.:....|...
  Rat   129 LSHPVSLSARIQPVCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRL 193

  Fly   195 YGNFGSI--TDRM-----LCAGLPEGGKDACQGDSGGPL----AADGVLWGVVSWGYGCARPNYP 248
            |....::  ::|:     ||||...|.||||||||||||    :...||.||||||.|||.||.|
  Rat   194 YHMGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRP 258

  Fly   249 GVYSRVSAVRDWISS 263
            |||:.|:....||.:
  Rat   259 GVYTNVAKYSPWIQA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/240 (38%)
Tryp_SPc 42..264 CDD:238113 92/243 (38%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 91/240 (38%)
Tryp_SPc 34..272 CDD:238113 91/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.