DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss36

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:250 Identity:89/250 - (35%)
Similarity:120/250 - (48%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHC--TEGS-------AIL 89
            ||....|||||..|:....|:||||.. ..|.|||||||..|||:||||  |.|:       ::|
  Rat    52 RPEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVL 116

  Fly    90 LSKVRIGSSRTSV-GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDAD 153
            |.   :.|....: |..:..:..:.....:....:..|.:||.|...:....:...|.||.....
  Rat   117 LG---VHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHL 178

  Fly   154 IADGTPVLVSGWGNTQSAQETSA--VLRSVTVPKVSQTQCTEAYGNFG------SITDRMLCAGL 210
            .|.||....:|||:.|.:.....  ||:.|.:..:.:|.|...|...|      .:...|||||.
  Rat   179 FAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGY 243

  Fly   211 PEGGKDACQGDSGGPLAA-DGVLW---GVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |||.:|.|||||||||.. ||..|   |:.|:|:||.|.|.|||::.|:....||
  Rat   244 PEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 85/242 (35%)
Tryp_SPc 42..264 CDD:238113 85/242 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 85/242 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.