DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and XB5758585

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:250 Identity:72/250 - (28%)
Similarity:125/250 - (50%) Gaps:20/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTAAHCTEGSAI 88
            |.|.||.....|.:|.:|:|..........:||.. .:.|.:||||||:..|:::||.|.:....
 Frog     5 VLLFLGVVAASPLVDDKIIGEYECAPHSQKWQVYFTYKGYPWCGGSLISSRWIISAASCNQSPKY 69

  Fly    89 LLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQ 150
            |::  .:|.   :|.....|.:.:::...|.::...:...:..|::|.|.:..|   .||    |
 Frog    70 LIA--HLGKHDITREEGTEQHIQVEKTFPHNRYLGLSDSNNIMLVKLAEPAQFN---QFV----Q 125

  Fly   151 DADIADGTP-----VLVSGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAG 209
            ...:|...|     ..|||:||..| |::....|:.:.:|.:.::.| :||.:...:...::|||
 Frog   126 PIKVASSCPREGKVCQVSGFGNLNSYAEKYPDRLQCLDLPILPESSC-DAYFSPKKMHTNLMCAG 189

  Fly   210 LPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ..:..||:||||:||||...|.|:|::.||..|:....||||.:|....:|:.::
 Frog   190 FAQDDKDSCQGDAGGPLICKGELYGIILWGNECSGRGIPGVYLKVCNFTNWMQNI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 65/229 (28%)
Tryp_SPc 42..264 CDD:238113 66/231 (29%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 65/228 (29%)
Tryp_SPc 22..244 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.