DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and try10

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:245 Identity:105/245 - (42%)
Similarity:148/245 - (60%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRP-RLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEG 85
            :||.:| ||..|.:| ..|.:||||...:   :||||||...|||||||||.:.||::||||.:.
 Frog     4 LLLFSL-LGLAVAQPIEDDDKIVGGYHCS---VPYQVSLNAGYHFCGGSLINEHWVVSAAHCYQS 64

  Fly    86 SAILLSKVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGL 147
            .    .::|||.:...:   ..|.:...::.|||:::::|||.|..|::|:|.:..|.....:.|
 Frog    65 K----MELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQLNNEVQPIPL 125

  Fly   148 PEQDADIADGTPVLVSGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLP 211
            |.:...:  |:..|:||||||.| ......:|:.:..|.:|..:|.::|.  |||||.|:|.|..
 Frog   126 PTECPPV--GSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYP--GSITDNMICVGYL 186

  Fly   212 EGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |||.|:||||||||:..||.|.||||||.|||.|.|||||::|.....||
 Frog   187 EGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/223 (43%)
Tryp_SPc 42..264 CDD:238113 97/224 (43%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 97/224 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.