DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC496633

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001011204.1 Gene:LOC496633 / 496633 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:248 Identity:91/248 - (36%)
Similarity:131/248 - (52%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTAAHCTEGS 86
            |.:.|.|......|..|.:||||........|:||.. |.:..||||||:...|:::||||....
 Frog     4 LWILLFLAVAAAAPLDDDKIVGGYECTPHSQPWQVYFTQENQVFCGGSLVTPRWIISAAHCYRTP 68

  Fly    87 AILLSKVRIGS-SRTSVGG--QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148
            ..|::  .:|. ..|...|  |.:.::.:::|..:....:|.|..|::|.:.:..|  |....:|
 Frog    69 KTLVA--HLGDHDLTKEEGTEQHIQVENIYKHFSYKDNDVDHDIMLVKLAKPAQYN--QYVQPIP 129

  Fly   149 EQDADIADGTPVLVSGWGNTQSAQ--ETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLP 211
            ...:...:||..||||:||.:|..  |....|:.|.||.:|.:.|..:|.  |..|:.|.|||..
 Frog   130 VARSCPREGTECLVSGYGNMRSDNIGEFPDRLQCVDVPVLSDSSCKASYR--GLFTENMFCAGFL 192

  Fly   212 EGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            |||||:||.||||||..:|.|:||||||.|||..|.||||::|.....|:..:
 Frog   193 EGGKDSCQVDSGGPLVCNGELYGVVSWGQGCAERNAPGVYAKVCNYLGWVQDI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 85/225 (38%)
Tryp_SPc 42..264 CDD:238113 86/227 (38%)
LOC496633NP_001011204.1 Tryp_SPc 23..245 CDD:238113 86/227 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.