DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prss27

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:277 Identity:103/277 - (37%)
Similarity:148/277 - (53%) Gaps:32/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQ 73
            |...|:.|.:.|..:..:|.|.  .:|....|||||..|...:.|:|||: .::.|.|||||::.
 Frog   390 MMLRIISLLLAGFAVTAISTGC--GQPAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSS 452

  Fly    74 GWVLTAAHC------TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLEL 132
            .||::||||      .|...:||....: .:.|| ...::.:|||..:|.:.......|.:::|:
 Frog   453 NWVVSAAHCFPRSYKIENMQVLLGCFAL-MNLTS-DAVIIRVKRVITYPLYTGEGSSGDIAMVEM 515

  Fly   133 EE---YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSA--VLRSVTVPKVSQTQCT 192
            |.   ||:..:.   :.:|..:.|...|....|:||||.||....|.  .|:.|.||.|:.:.|.
 Frog   516 ESPVTYSSYILP---ICIPLTNEDFPSGKMCWVTGWGNIQSDVSLSPPYPLQEVEVPLVNASSCD 577

  Fly   193 EAYGNFGS--------ITDRMLCAGLPEGGKDACQGDSGGPLAA-DGVLW---GVVSWGYGCARP 245
            ..| ::.|        :.|.|:|||.|||.|||||||||||||. .|..|   |:||||.|||:|
 Frog   578 TMY-HYNSDLNPATQLVHDDMICAGYPEGQKDACQGDSGGPLACKSGNYWFLTGIVSWGDGCAQP 641

  Fly   246 NYPGVYSRVSAVRDWIS 262
            |.||||::||:...||:
 Frog   642 NRPGVYTKVSSFSSWIN 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 94/243 (39%)
Tryp_SPc 42..264 CDD:238113 95/245 (39%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 95/245 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.