DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and betaTry

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:109/249 - (43%)
Similarity:149/249 - (59%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILL--VNLSLGATVRR---PRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAA 80
            |||  |..:||.|:..   |:||||||||....|...|:|:||||| .|.||||:.:...::|||
  Fly     6 ILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAA 70

  Fly    81 HCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFV 145
            ||.:..:....::|.|||..|.||.:..:.....|..::|.|:..|.::|.|....:.:.|...:
  Fly    71 HCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAI 135

  Fly   146 GLPEQDADIADGTPVLVSGWGNTQSAQETS--AVLRSVTVPKVSQTQC-TEAYGNFGSITDRMLC 207
            ||...:.  |:|....||||| |:|:..:|  :.||.|.|..|||::| :.:||....|...|:|
  Fly   136 GLASSNP--ANGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMIC 197

  Fly   208 AGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |.  ..|||:|||||||||.:.|||.||||||||||..||||||:.|:|:|.|:
  Fly   198 AF--ASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 97/223 (43%)
Tryp_SPc 42..264 CDD:238113 97/224 (43%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 97/223 (43%)
Tryp_SPc 31..252 CDD:238113 97/224 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.