DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and zgc:92590

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:258 Identity:96/258 - (37%)
Similarity:142/258 - (55%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL--QRSYHFCGGSLIAQGWVL 77
            :.:.:..:|::.::..|       |.:|:||...:....|:|:.|  .....:||.|||...|.:
Zfish     1 MKMIVFALLVLAVACSA-------DDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAV 58

  Fly    78 TAAHCTEGSAILLSK---VRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYS 136
            :||||     .|::.   |.:|....:|   ..|.:..::|..|||::.||:|.||.|::|:|.:
Zfish    59 SAAHC-----YLVANRLTVHLGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPA 118

  Fly   137 AKNVTQAFVGLPEQDADIADGTPVLVSGWGN-TQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGS 200
            ..|  |....:|...:..::|...||||||| ..:......||:.:.:|.:::.||..|||  ..
Zfish   119 VFN--QYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYG--WQ 179

  Fly   201 ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            ||..|.|||..||||||||||||||:..:|.|.||||||||||...|||||:.|....||::|
Zfish   180 ITKNMFCAGFMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWVAS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/228 (40%)
Tryp_SPc 42..264 CDD:238113 93/231 (40%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 91/228 (40%)
Tryp_SPc 21..243 CDD:238113 93/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.