DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prtn3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:246 Identity:79/246 - (32%)
Similarity:115/246 - (46%) Gaps:18/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSL--GATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTE 84
            |||.||:  .:.|....:..:||||:.|.....||..||| |..|||||||||..:::|||||.|
 Frog     5 LLVTLSILWASQVNGGSMHTQIVGGREATPNSHPYIASLQLRGRHFCGGSLIAPQFLMTAAHCME 69

  Fly    85 GSAILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVG 146
            .:|..|..|.:|:   .......|...:.:|..: .|:..|:..|..:|:|:...:.|.....|.
 Frog    70 NTASNLVTVVLGAHSLRANEATKQRFRVNQVFEN-GFNPLTLQNDIVILKLDRPVSLNGKVQVVS 133

  Fly   147 LPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLP 211
            ||..:.|:..||..:.:|||...:..:....|:.:.|....|..|          ....:|.|:.
 Frog   134 LPSANEDVPAGTQCVTAGWGRLSTEGQIPDRLQELNVTVTRQNLC----------RPNNICTGVF 188

  Fly   212 EGGKDACQGDSGGPLAADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWI 261
            ......|.|||||||..:||:.|:.|:.. .|.....|..:||||..|.:|
 Frog   189 MQQAGICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 72/224 (32%)
Tryp_SPc 42..264 CDD:238113 73/225 (32%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 73/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.