DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK14

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:231 Identity:88/231 - (38%)
Similarity:123/231 - (53%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSL---QRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGS--- 97
            :.:|:||........|:|.:|   .|....|||:|::..||:|||||  |..||  :|.:|.   
Human    22 ENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHC--GRPIL--QVALGKHNL 82

  Fly    98 SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLV 162
            .|.....|::.:.|...||.:::.|.|.|..||:|::  ...:.:|...:....|..:.||...|
Human    83 RRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQ--PARIGRAVRPIEVTQACASPGTSCRV 145

  Fly   163 SGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPL 226
            ||||...| .....|.|:.|.:.......|.:||..  :||..|:|||:|:||||:|||||||||
Human   146 SGWGTISSPIARYPASLQCVNINISPDEVCQKAYPR--TITPGMVCAGVPQGGKDSCQGDSGGPL 208

  Fly   227 AADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWI 261
            ...|.|.|:||||. .||.|.|||||:.:...|.||
Human   209 VCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 86/227 (38%)
Tryp_SPc 42..264 CDD:238113 88/228 (39%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 88/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3308
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.