DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Gm5771

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:243 Identity:105/243 - (43%)
Similarity:135/243 - (55%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSA 87
            ||....:||.|..|..|.:||||.......:||||||...|||||||||...||::||||.:...
Mouse     4 LLFLALVGAAVAFPVDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKTRI 68

  Fly    88 ILLSKVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPE 149
                :||:|.....|   ..|.|...::.:||.|:..|::.|..|::|......|...|.|.||.
Mouse    69 ----QVRLGEHNIKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPS 129

  Fly   150 QDADIADGTPVLVSGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEG 213
            ..|..  ||..|:||||||.| ......:|:.:..|.:.|..|..:|.  |.||..|:|||..||
Mouse   130 SCAPA--GTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYP--GKITGNMVCAGFLEG 190

  Fly   214 GKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |||:||||||||:..:|.|.|:||||||||..:.||||::|....|||
Mouse   191 GKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 96/223 (43%)
Tryp_SPc 42..264 CDD:238113 98/224 (44%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 96/223 (43%)
Tryp_SPc 23..241 CDD:238113 98/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3329
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3860
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.