DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Try10

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:246 Identity:106/246 - (43%)
Similarity:137/246 - (55%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRP-RLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGS 86
            ||....:||.|..| ..|.:||||.......:||||||...|||||||||...||::||||.:..
Mouse     4 LLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSR 68

  Fly    87 AILLSKVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148
            .    :||:|....:|   ..|.:....:.:||||...|:|.|..|::|......|...|.|.||
Mouse    69 I----QVRLGEHNINVLEGNEQFIDAANIIKHPKFKKKTLDNDIMLIKLSSPVTLNARVATVALP 129

  Fly   149 EQDADIADGTPVLVSGWGNT-QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPE 212
            ...|  |.||..|:|||||| .|......:|:.:..|.:.|..|..:|.  |.||..|:|.|..|
Mouse   130 SSCA--AAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEASYP--GKITKNMICVGFLE 190

  Fly   213 GGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            ||||:||||||||:..:|.|.|:||||||||:.:.||||::|....|||.:
Mouse   191 GGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDWIQN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 97/223 (43%)
Tryp_SPc 42..264 CDD:238113 99/226 (44%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 97/223 (43%)
Tryp_SPc 24..242 CDD:238113 99/226 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3329
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3860
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10390
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.