DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:244 Identity:88/244 - (36%)
Similarity:123/244 - (50%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LDGRIVGGQVANIKDIPYQVSLQRSYH---FCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSS- 98
            :.|||..|..|....:||.|.|..|.:   :||||:|...|||||||||.|::.:  .:..|:| 
  Fly    32 IQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV--TINYGASI 94

  Fly    99 RTSVG-GQLVGIKRVHRHPKFDAYTIDFDFSLL---ELEEYSAKNVTQAFVGLPEQDADIAD--G 157
            ||... ...||...:.:|..:::..:..|.||:   .::.:|..|.    |.||..:....|  |
  Fly    95 RTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNK----VELPSYNDRYQDYAG 155

  Fly   158 TPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDS 222
            ...:.||||.|.........|:||.|..:||:.|:..:    |:.|.|:|.. .:|||..|.|||
  Fly   156 WWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW----SLHDNMICIN-TDGGKSTCGGDS 215

  Fly   223 GGPLAA-DG-VLWGVVSWG--YGCARPNYPGVYSRVSAVRDWISSVSGI 267
            ||||.. || .|.||.|:|  .|| :...|.|:|||:...|||...:||
  Fly   216 GGPLVTHDGNRLVGVTSFGSAAGC-QSGAPAVFSRVTGYLDWIRDNTGI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 83/233 (36%)
Tryp_SPc 42..264 CDD:238113 84/235 (36%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 84/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.